How to Stay Active During Pregnancy: Pro Athlete Tips

advanced11 min readLifestyleby QuickHowTos Editorial · Updated

How to Stay Active During Pregnancy: Pro Athlete Tips

Elite athletes maintain fitness during pregnancy by getting medical clearance first, choosing safe low-impact exercises, and adjusting intensity each trimester. Consistency over intensity is the key — moderate activity benefits both mother and baby throughout a healthy pregnancy.

Key Takeaways

  • Always get OB-GYN clearance before starting or continuing any exercise routine during pregnancy.
  • Focus on low-impact activities — swimming, walking, prenatal yoga — safe across all three trimesters.
  • Scale back intensity after 20 weeks and prioritize pelvic floor and breathing work in trimester three.

Carli Lloyd and the Pregnancy Trending Search

Carli Lloyd, two-time FIFA World Cup champion and two-time Olympic gold medalist, retired from professional soccer in October 2021 after a celebrated career with the United States Women's National Team. Since her retirement, fans have remained deeply curious about her personal life — including whether she and her husband Brian Hollins have started or grown a family.

As of June 2026, Carli Lloyd has not made any public pregnancy announcement. The trending search appears driven by general curiosity from her fanbase rather than a confirmed news event. If and when she makes any announcement, it will appear on her verified social media channels.

That said, the curiosity around pregnancy and elite athletes raises genuinely important questions: How do professional athletes approach pregnancy? What does staying active look like when your body is built for peak performance? This guide answers those questions with practical, evidence-based steps any active woman can follow during pregnancy.

Step 1: Get Medical Clearance Before Anything Else

Before continuing or starting any exercise program during pregnancy, schedule an appointment with your OB-GYN or midwife. This is non-negotiable — even for elite athletes who are accustomed to training at high intensity.

At your appointment, your provider will assess:

  • Current pregnancy status and gestational age — exercise guidelines shift significantly by trimester
  • Any complicating factors — placenta previa, cervical incompetence, pre-eclampsia history, or multiple gestation all change what is safe
  • Personalized intensity targets — the outdated 140 bpm maximum heart rate rule has been replaced by individualized guidelines; your provider will give you specific targets based on your fitness history
  • Warning signs to stop immediately — chest pain, dizziness, severe shortness of breath, contractions, vaginal bleeding, or decreased fetal movement all require stopping exercise and contacting your provider

Bring a list of your current workouts, frequency, and intensity levels. Your provider can then recommend specific modifications rather than a blanket restriction. Most healthy pregnant women can continue most of their pre-pregnancy exercise with reasonable adjustments — the goal is not to stop moving, but to move smarter.

Step 2: First Trimester Exercise — Building Safe Habits (Weeks 1–12)

The first trimester brings fatigue, nausea, and significant hormonal changes that make intense training difficult. This is a period of adaptation, not performance. Your body is doing enormous work — allow it to.

What to do in trimester one:

  • Walking: 30 minutes at a brisk pace, 5 days a week. This alone meets the weekly aerobic guideline and is safe even on days with nausea. Break it into two 15-minute walks if needed.
  • Swimming or water aerobics: Buoyancy reduces joint stress and regulates body temperature naturally. Aim for 3 sessions of 20–30 minutes at conversational pace.
  • Light strength training: 2 sessions per week. Prefer machines or resistance bands rather than free weights that require significant balance and core bracing. Keep loads at 60–70% of your normal working weight.
  • Prenatal yoga or Pilates: Focus on breathing, flexibility, and gentle core engagement. Avoid deep twists and positions that compress the abdomen.

What to modify or avoid:

  • Exercise in extreme heat or humidity — core temperature regulation is impaired during pregnancy and overheating is a fetal risk
  • Heavy maximal lifts — reduce loads and focus on controlled movement
  • High-impact plyometrics and activities with meaningful fall risk

The talk test is the most reliable intensity guide during pregnancy: if you can hold a full conversation while exercising but feel your breathing rate is elevated, you are at the right intensity. If you cannot complete a sentence, back off immediately.

Step 3: Second Trimester — Adapt as Your Body Changes (Weeks 13–26)

Most women feel their best in the second trimester — nausea typically subsides and energy returns. However, the growing uterus begins to affect balance and center of gravity, and the hormone relaxin increases joint laxity, raising injury risk if you train carelessly.

Key adaptations to make in trimester two:

  • Switch from lying flat exercises after week 20: The growing uterus can compress the inferior vena cava, reducing blood return to the heart and causing dizziness. Replace bench press and floor ab work with incline or seated variations.
  • Widen your stance: On squats, lunges, and deadlifts, take a wider base to accommodate your growing belly and shifted center of gravity. This reduces balance demands and keeps the movement safe.
  • Reduce running mileage: If you run regularly, reduce total weekly mileage by 25–40% and substitute some sessions with cycling or the elliptical, which are lower-impact and continue to build aerobic fitness.
  • Add dedicated pelvic floor work: Begin Kegel exercises — 3 sets of 10 holds of 10 seconds each, performed daily. Contract the pelvic floor muscles as if stopping the flow of urine, hold, then fully release. This is one of the highest-return investments for labor and postpartum recovery.

Sample second-trimester workout structure (3x per week):

  1. Session A: 20-minute swim at moderate effort + 10 minutes of pool walking
  2. Session B: 30-minute stationary bike at moderate resistance, maintaining conversational pace
  3. Session C: Full-body resistance session — goblet squats, seated cable rows, dumbbell shoulder press, Romanian deadlifts with reduced load, banded clamshells

Monitor recovery between sessions. Some days will feel strong; others you will need to cut the session short. Both responses are completely normal and should guide your effort on any given day.

Step 4: Third Trimester — Comfort, Mobility, and Preparation (Weeks 27–40)

The third trimester demands significant exercise modifications. Your center of gravity has shifted substantially, ligaments are at peak laxity, and cardiac output is elevated even at rest. Exercise remains clearly beneficial for mood, circulation, and labor preparation — but intensity should decrease meaningfully from your second-trimester baseline.

What works well in trimester three:

  • Daily walking: Continue daily walks. Even 20–25 minutes at a comfortable pace is sufficient and beneficial. Use good footwear with arch support as foot pronation increases with weight gain.
  • Prenatal yoga: Focus on hip-opening positions (modified cat-cow, supported butterfly, wide-knee child's pose), breathing techniques such as slow diaphragmatic breathing, and relaxation practices that are directly useful during labor.
  • Water exercise: Pool walking and gentle water aerobics remain comfortable even in late pregnancy. Buoyancy dramatically reduces the perceived weight of the belly and joint load throughout.
  • Seated upper body resistance work: Light dumbbell exercises performed seated on a bench — bicep curls, overhead press, lateral raises — maintain upper body strength without core compression or balance demands.

What to stop in trimester three:

  • Running if it causes pelvic pain, leaking urine, or significant downward pressure — these are signs the pelvic floor is under excessive load
  • All exercises performed flat on your back
  • Heavy compound lifts requiring breath-holding under load
  • Contact sports or any activity with meaningful fall risk

The primary goal in trimester three is maintaining circulation, managing back pain, preparing the pelvis for birth, and preserving enough baseline fitness to support a smoother postpartum recovery. You are not training for performance — you are preparing for labor, which is its own athletic event.

Nutrition for Active Pregnant Women

Exercise during pregnancy increases caloric and nutrient needs beyond the standard pregnancy recommendations. Here is a practical, evidence-based framework:

Additional caloric needs by trimester:

  • Trimester 1: No additional calories beyond your pre-pregnancy baseline are required in most cases
  • Trimester 2: Add approximately 340 calories per day above your pre-pregnancy maintenance level
  • Trimester 3: Add approximately 450 calories per day above baseline
  • If exercising 45 or more minutes per session, add 200–300 more calories on training days specifically

Critical nutrients for active pregnant women:

  • Iron — 27 mg/day: Blood volume increases approximately 50% during pregnancy, creating dramatically higher iron demands. Prioritize lean red meat, legumes, fortified cereals, and dark leafy greens. Pair iron-rich foods with vitamin C (orange juice, bell peppers) to improve absorption by up to 3x.
  • Calcium — 1,000 mg/day: The developing baby draws calcium from your bones if dietary intake is insufficient. Dairy products, fortified plant milks, sardines with bones, and almonds are reliable sources.
  • DHA omega-3 — 200–300 mg/day: Supports fetal brain and retinal development. Found in fatty fish (salmon, sardines, mackerel) or a prenatal DHA supplement. Limit high-mercury fish (swordfish, king mackerel) to once per month.
  • Protein — minimum 71 g/day: Aim higher if training regularly. Include protein at every meal — eggs, Greek yogurt, legumes, poultry, and cottage cheese are practical choices.

Hydration during exercise is critical. Drink 8–10 oz of water before exercise, sip 4–6 oz every 15 minutes during activity, and rehydrate with at least 8 oz after. Dehydration can trigger Braxton Hicks contractions and raises core temperature. If your urine is dark yellow, drink more water before your next session.

Postpartum Return to Fitness: What Pro Athletes Do

Professional athletes face the same postpartum recovery process as all new mothers, but with added pressure to return to competition quickly. Understanding how elite athletes navigate this transition safely provides a useful roadmap for any active woman.

Weeks 1–6: Rest and healing first

The uterus needs 6 weeks to involute back to its pre-pregnancy size. Walking is the recommended activity during this window — nothing high-impact. For cesarean delivery, abdominal loading exercises should wait until the incision has fully healed, typically 10–12 weeks minimum. Use this period to rest, establish breastfeeding if planned, and sleep when possible.

Weeks 6–12: Pelvic floor rehabilitation — the most important step

Before returning to running, jumping, or heavy lifting, work with a pelvic floor physiotherapist. They use internal and external assessment to check for:

  • Pelvic floor muscle weakness or, conversely, hypertonicity (too tight, which can cause pain)
  • Diastasis recti — abdominal wall separation that occurs in the majority of pregnancies and affects core stability and loading capacity
  • Prolapse symptoms such as pelvic pressure, heaviness, or leaking urine during activity

This step is non-negotiable for elite athletes returning to sport and is frequently skipped by recreational athletes — often leading to long-term pelvic floor problems. Schedule this appointment at or after your 6-week postpartum check, or earlier if you have concerns.

Weeks 12–24: Progressive return to training

  1. Return to running protocol: Start with a walk-run program — 1 minute running, 2 minutes walking, repeated 10 times, 3 sessions per week. Progress the running interval by 1 minute every 2 weeks if asymptomatic.
  2. Reintroduce resistance training: Start at 40–50% of pre-pregnancy working loads. Progress based on how your body responds — not on a fixed week-by-week schedule.
  3. Sport-specific training: Add sport-specific drills and agility work no earlier than 20 weeks postpartum once all foundational strength markers are stable.

Most elite professional athletes return to full competition 9–18 months postpartum. Patience and systematic progressive overload — not urgency — determine both the speed and quality of return. Returning too soon increases injury risk substantially, which is the one outcome that extends time away from sport the most.

Frequently Asked Questions

Is Carli Lloyd pregnant in 2025 or 2026?

Carli Lloyd has not made any public pregnancy announcement as of mid-2026. The search trend appears to be driven by general curiosity following her 2021 retirement from professional soccer. Any confirmed pregnancy news would be announced through her official social media channels.

Is it safe to exercise during pregnancy?

Yes, for most healthy pregnancies. The American College of Obstetricians and Gynecologists recommends 150 minutes of moderate-intensity aerobic activity per week throughout pregnancy. Always obtain clearance from your healthcare provider first, particularly if you have any complications such as placenta previa or pre-eclampsia risk.

When should you stop high-intensity workouts during pregnancy?

Most physicians recommend scaling back high-intensity interval training and contact sports by the second trimester. Transition to moderate-intensity cardio and strength work. Stop immediately if you experience dizziness, chest pain, shortness of breath, contractions, or vaginal bleeding, and contact your doctor right away.

Can exercise during pregnancy harm the baby?

Moderate exercise does not harm a healthy pregnancy. It reduces gestational diabetes risk, improves mood, and may ease labor. Avoid exercises that risk falls such as skiing or horseback riding, lying flat on your back after 20 weeks due to vena cava compression, and contact sports with collision risk.

How do professional female athletes return to sport after pregnancy?

Recovery typically takes 6 to 12 months post-delivery. Athletes focus first on pelvic floor rehabilitation with a specialist physiotherapist, then rebuild core stability, then gradually return to sport-specific training. Hormonal changes during breastfeeding affect joint laxity, so most athletes wait until after weaning to return to full competition load.

Get the next how-to in your inbox

One useful how-to when we publish something new — no spam, unsubscribe anytime.

Related Topics

pregnancyyourtrimesterexerciseathletesintensityweekspelvicmostfloor